| Class c: Alpha and beta proteins (a/b) [51349] (117 folds) |
| Fold c.51: Anticodon-binding domain-like [52953] (4 superfamilies) |
Superfamily c.51.1: Anticodon-binding domain of Class II aaRS [52954] (1 family) ![]() |
| Family c.51.1.1: Anticodon-binding domain of Class II aaRS [52955] (5 proteins) |
| Protein C-terminal domain of ProRS [64071] (1 species) |
| Species Thermus thermophilus [TaxId:274] [64072] (4 PDB entries) |
| Domain d1h4sb1: 1h4s B:277-403 [60607] Other proteins in same PDB: d1h4sa2, d1h4sa3, d1h4sb2, d1h4sb3 |
PDB Entry: 1h4s (more details), 2.85 Å
SCOP Domain Sequences for d1h4sb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1h4sb1 c.51.1.1 (B:277-403) C-terminal domain of ProRS {Thermus thermophilus}
rglvlpprlapiqvvivpiykdesrervleaaqglrqallaqglrvhlddrdqhtpgykf
hewelkgvpfrvelgpkdleggqavlasrlggketlplaalpealpgkldafheelyrra
lafredh
Timeline for d1h4sb1: