Lineage for d1h4sa2 (1h4s A:5-276)

  1. Root: SCOP 1.61
  2. 187024Class d: Alpha and beta proteins (a+b) [53931] (212 folds)
  3. 195363Fold d.104: Class II aaRS and biotin synthetases [55680] (1 superfamily)
  4. 195364Superfamily d.104.1: Class II aaRS and biotin synthetases [55681] (2 families) (S)
  5. 195365Family d.104.1.1: Class II aminoacyl-tRNA synthetase (aaRS)-like, catalyic domain [55682] (12 proteins)
  6. 195461Protein Prolyl-tRNA synthetase (ProRS) [64347] (1 species)
  7. 195462Species Thermus thermophilus [TaxId:274] [64348] (4 PDB entries)
  8. 195467Domain d1h4sa2: 1h4s A:5-276 [60605]
    Other proteins in same PDB: d1h4sa1, d1h4sa3, d1h4sb1, d1h4sb3

Details for d1h4sa2

PDB Entry: 1h4s (more details), 2.85 Å

PDB Description: prolyl-trna synthetase from thermus thermophilus complexed with trnapro(cgg) and a prolyl-adenylate analogue

SCOP Domain Sequences for d1h4sa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1h4sa2 d.104.1.1 (A:5-276) Prolyl-tRNA synthetase (ProRS) {Thermus thermophilus}
kgltpqsqdfsewyleviqkaeladygpvrgtivvrpygyaiweniqqvldrmfketghq
nayfplfipmsflrkeaehvegfspelavvthaggeeleeplavrptsetvigymwskwi
rswrdlpqllnqwgnvvrwemrtrpflrtseflwqeghtahatreeaeeevrrmlsiyar
lareyaaipvieglktekekfagavytttiealmkdgkalqagtshylgenfarafdikf
qdrdlqvkyvhttswglswrfigaiimthgdd

SCOP Domain Coordinates for d1h4sa2:

Click to download the PDB-style file with coordinates for d1h4sa2.
(The format of our PDB-style files is described here.)

Timeline for d1h4sa2: