SCOP 1.63: Domain d1giyr_: 1giy R:

Lineage for d1giyr_ (1giy R:)

1. Root: SCOP 1.63

2. Class i: Low resolution protein structures [58117] (18 folds)

3. Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily)

4. Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families)

5. Family i.1.1.1: Ribosome complexes [58120] (1 protein)

6. Protein 70S ribosome functional complex [58121] (2 species)

7. Species Thermus thermophilus [TaxId:274] [58122] (9 PDB entries)

8. Domain d1giyr_: 1giy R: [60565]

Details for d1giyr_

PDB Entry: 1giy, 5.5 Å

PDB Description: crystal structure of the ribosome at 5.5 a resolution. this file, 1giy, contains the 50s ribosome subunit. the 30s ribosome subunit, three trna, and mrna molecules are in the file 1gix

SCOP Domain Sequences for d1giyr_:

Sequence, based on SEQRES records:

>d1giyr_ i.1.1.1 (R:) 70S ribosome functional complex {Thermus thermophilus}
recdycgtdiepgtgtmfvhkdgatthfcsskcennadlgrearnlewtdtar

Sequence, based on observed residues (ATOM records):

>d1giyr_ i.1.1.1 (R:) 70S ribosome functional complex {Thermus thermophilus}
recdycgtdiepgtgtmfvhkdgatthfcsskcennadlrearnlewtdtar

Timeline for d1giyr_:

• d1giyr_ first appeared in SCOP 1.57
  
• d1giyr_ appears in SCOP 1.61
  
• d1giyr_ appears in SCOP 1.65
  
• d1giyr_ appears in the current release, SCOPe 2.08