Lineage for d1giyw_ (1giy W:)

  1. Root: SCOP 1.63
  2. 272796Class i: Low resolution protein structures [58117] (18 folds)
  3. 272797Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily)
  4. 272798Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) (S)
  5. 272799Family i.1.1.1: Ribosome complexes [58120] (1 protein)
  6. 272800Protein 70S ribosome functional complex [58121] (2 species)
  7. 272864Species Thermus thermophilus [TaxId:274] [58122] (9 PDB entries)
  8. 272992Domain d1giyw_: 1giy W: [60570]

Details for d1giyw_

PDB Entry: 1giy (more details), 5.5 Å

PDB Description: crystal structure of the ribosome at 5.5 a resolution. this file, 1giy, contains the 50s ribosome subunit. the 30s ribosome subunit, three trna, and mrna molecules are in the file 1gix

SCOP Domain Sequences for d1giyw_:

Sequence, based on SEQRES records: (download)

>d1giyw_ i.1.1.1 (W:) 70S ribosome functional complex {Thermus thermophilus}
tvlhvqeirdmtpaereaelddlktellnaravqaaggapenpgrikelrkaiariktiq
geegd

Sequence, based on observed residues (ATOM records): (download)

>d1giyw_ i.1.1.1 (W:) 70S ribosome functional complex {Thermus thermophilus}
tvlhvqeirdmtpaereaelddlktellnarvqaaggapenpgrikelrkaiariktiqg
eegd

SCOP Domain Coordinates for d1giyw_:

Click to download the PDB-style file with coordinates for d1giyw_.
(The format of our PDB-style files is described here.)

Timeline for d1giyw_: