Lineage for d1gixs_ (1gix S:)

  1. Root: SCOPe 2.08
  2. 3042554Class i: Low resolution protein structures [58117] (25 folds)
  3. 3042555Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily)
  4. 3042556Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) (S)
  5. 3042557Family i.1.1.1: Ribosome complexes [58120] (3 proteins)
  6. 3042558Protein 70S ribosome functional complex [58121] (4 species)
  7. 3043115Species Thermus thermophilus [TaxId:274] [58122] (20 PDB entries)
  8. 3043248Domain d1gixs_: 1gix S: [60542]

Details for d1gixs_

PDB Entry: 1gix (more details), 5.5 Å

PDB Description: Crystal structure of the ribosome at 5.5 A resolution. This file, 1GIX, contains the 30S ribosome subunit, three tRNA, and mRNA molecules. 50S ribosome subunit is in the file 1GIY
PDB Compounds: (S:) 30S ribosomal protein S16

SCOPe Domain Sequences for d1gixs_:

Sequence, based on SEQRES records: (download)

>d1gixs_ i.1.1.1 (S:) 70S ribosome functional complex {Thermus thermophilus [TaxId: 274]}
mvkirlarfgskhnphyphyrivvtdarrkrdgkyiekigyydprkttpdwlkvdverar
ywlsvgaqptdtarrllrqagvfrqe

Sequence, based on observed residues (ATOM records): (download)

>d1gixs_ i.1.1.1 (S:) 70S ribosome functional complex {Thermus thermophilus [TaxId: 274]}
mvkirlarfgskhnphyrivvtdarrkrdgkyiekigyydprkttpdwlkvdverarywl
svgaqptdtarrllrqagvfrqe

SCOPe Domain Coordinates for d1gixs_:

Click to download the PDB-style file with coordinates for d1gixs_.
(The format of our PDB-style files is described here.)

Timeline for d1gixs_: