Lineage for d1gixq_ (1gix Q:)

  1. Root: SCOPe 2.08
  2. 3042554Class i: Low resolution protein structures [58117] (25 folds)
  3. 3042555Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily)
  4. 3042556Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) (S)
  5. 3042557Family i.1.1.1: Ribosome complexes [58120] (3 proteins)
  6. 3042558Protein 70S ribosome functional complex [58121] (4 species)
  7. 3043115Species Thermus thermophilus [TaxId:274] [58122] (20 PDB entries)
  8. 3043246Domain d1gixq_: 1gix Q: [60540]

Details for d1gixq_

PDB Entry: 1gix (more details), 5.5 Å

PDB Description: Crystal structure of the ribosome at 5.5 A resolution. This file, 1GIX, contains the 30S ribosome subunit, three tRNA, and mRNA molecules. 50S ribosome subunit is in the file 1GIY
PDB Compounds: (Q:) 30S ribosomal protein S14

SCOPe Domain Sequences for d1gixq_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gixq_ i.1.1.1 (Q:) 70S ribosome functional complex {Thermus thermophilus [TaxId: 274]}
arkaliekakrtpkfkvraytrcvrcgrarsvyrffglcriclrelahkgqlpgvrkasw

SCOPe Domain Coordinates for d1gixq_:

Click to download the PDB-style file with coordinates for d1gixq_.
(The format of our PDB-style files is described here.)

Timeline for d1gixq_: