Class i: Low resolution protein structures [58117] (25 folds) |
Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily) |
Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) |
Family i.1.1.1: Ribosome complexes [58120] (3 proteins) |
Protein 70S ribosome functional complex [58121] (4 species) |
Species Thermus thermophilus [TaxId:274] [58122] (20 PDB entries) |
Domain d1gixu_: 1gix U: [60544] |
PDB Entry: 1gix (more details), 5.5 Å
SCOPe Domain Sequences for d1gixu_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1gixu_ i.1.1.1 (U:) 70S ribosome functional complex {Thermus thermophilus [TaxId: 274]} psrkakvkatlgefdlrdyrnvevlkrflsetgkilprrrtglsgkeqrilaktikrari lgllpfteklvrk
Timeline for d1gixu_: