SCOPe 2.08: Domain d1ghqc2: 1ghq C:67-134

Lineage for d1ghqc2 (1ghq C:67-134)

1. Root: SCOPe 2.08

2. Class g: Small proteins [56992] (100 folds)

3. Fold g.18: Complement control module/SCR domain [57534] (1 superfamily)
   disulfide-rich all-beta fold

4. Superfamily g.18.1: Complement control module/SCR domain [57535] (2 families)

5. Family g.18.1.1: Complement control module/SCR domain [57536] (15 proteins)
   Pfam PF00084

6. Protein Complement receptor 2, cr2 [64564] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [64565] (4 PDB entries)

8. Domain d1ghqc2: 1ghq C:67-134 [60525]
   Other proteins in same PDB: d1ghqa1, d1ghqa2, d1ghqb3, d1ghqc3
   complexed with C3D
   complexed with ndg, zn

Details for d1ghqc2

PDB Entry: 1ghq, 2.04 Å

PDB Description: cr2-c3d complex structure

PDB Compounds: (C:) cr2/cd121/c3d/epstein-barr virus receptor

SCOPe Domain Sequences for d1ghqc2:

Sequence; same for both SEQRES and ATOM records:

>d1ghqc2 g.18.1.1 (C:67-134) Complement receptor 2, cr2 {Human (Homo sapiens) [TaxId: 9606]}
nkysscpepivpggykirgstpyrhgdsvtfacktnfsmngnksvwcqannmwgptrlpt
cvsvfple

Timeline for d1ghqc2:

• d1ghqc2 first appeared in SCOP 1.57
  
• d1ghqc2 appears in SCOPe 2.07