![]() | Class g: Small proteins [56992] (100 folds) |
![]() | Fold g.18: Complement control module/SCR domain [57534] (1 superfamily) disulfide-rich all-beta fold |
![]() | Superfamily g.18.1: Complement control module/SCR domain [57535] (2 families) ![]() |
![]() | Family g.18.1.1: Complement control module/SCR domain [57536] (15 proteins) Pfam PF00084 |
![]() | Protein Complement receptor 2, cr2 [64564] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [64565] (4 PDB entries) |
![]() | Domain d1ghqc1: 1ghq C:2-66 [60524] Other proteins in same PDB: d1ghqa1, d1ghqa2, d1ghqb3, d1ghqc3 complexed with C3D complexed with ndg, zn |
PDB Entry: 1ghq (more details), 2.04 Å
SCOPe Domain Sequences for d1ghqc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ghqc1 g.18.1.1 (C:2-66) Complement receptor 2, cr2 {Human (Homo sapiens) [TaxId: 9606]} iscgspppilngrisyystpiavgtviryscsgtfrligeksllcitkdkvdgtwdkpap kceyf
Timeline for d1ghqc1: