Lineage for d1ghqc1 (1ghq C:1-66)

  1. Root: SCOPe 2.03
  2. 1458801Class g: Small proteins [56992] (90 folds)
  3. 1462047Fold g.18: Complement control module/SCR domain [57534] (1 superfamily)
    disulfide-rich all-beta fold
  4. 1462048Superfamily g.18.1: Complement control module/SCR domain [57535] (1 family) (S)
  5. 1462049Family g.18.1.1: Complement control module/SCR domain [57536] (14 proteins)
    Pfam PF00084
  6. 1462242Protein Complement receptor 2, cr2 [64564] (1 species)
  7. 1462243Species Human (Homo sapiens) [TaxId:9606] [64565] (4 PDB entries)
  8. 1462248Domain d1ghqc1: 1ghq C:1-66 [60524]
    Other proteins in same PDB: d1ghqa_
    complexed with C3D
    complexed with ndg, zn

Details for d1ghqc1

PDB Entry: 1ghq (more details), 2.04 Å

PDB Description: cr2-c3d complex structure
PDB Compounds: (C:) cr2/cd121/c3d/epstein-barr virus receptor

SCOPe Domain Sequences for d1ghqc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ghqc1 g.18.1.1 (C:1-66) Complement receptor 2, cr2 {Human (Homo sapiens) [TaxId: 9606]}
aiscgspppilngrisyystpiavgtviryscsgtfrligeksllcitkdkvdgtwdkpa
pkceyf

SCOPe Domain Coordinates for d1ghqc1:

Click to download the PDB-style file with coordinates for d1ghqc1.
(The format of our PDB-style files is described here.)

Timeline for d1ghqc1: