SCOP 1.71: Domain d1ghqb2: 1ghq B:67-129

Lineage for d1ghqb2 (1ghq B:67-129)

1. Root: SCOP 1.71

2. Class g: Small proteins [56992] (79 folds)

3. Fold g.18: Complement control module/SCR domain [57534] (1 superfamily)
   disulfide-rich all-beta fold

4. Superfamily g.18.1: Complement control module/SCR domain [57535] (1 family)

5. Family g.18.1.1: Complement control module/SCR domain [57536] (11 proteins)
   Pfam 00084

6. Protein Complement receptor 2, cr2 [64564] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [64565] (2 PDB entries)

8. Domain d1ghqb2: 1ghq B:67-129 [60523]
   Other proteins in same PDB: d1ghqa_

Details for d1ghqb2

PDB Entry: 1ghq, 2.04 Å

PDB Description: cr2-c3d complex structure

SCOP Domain Sequences for d1ghqb2:

Sequence; same for both SEQRES and ATOM records:

>d1ghqb2 g.18.1.1 (B:67-129) Complement receptor 2, cr2 {Human (Homo sapiens)}
nkysscpepivpggykirgstpyrhgdsvtfacktnfsmngnksvwcqannmwgptrlpt
cvs

Timeline for d1ghqb2:

• d1ghqb2 first appeared in SCOP 1.57
  
• d1ghqb2 appears in SCOP 1.69
  
• d1ghqb2 appears in SCOP 1.73
  
• d1ghqb2 appears in the current release, SCOPe 2.08