Lineage for d1ghqb2 (1ghq B:67-129)

  1. Root: SCOP 1.69
  2. 520835Class g: Small proteins [56992] (75 folds)
  3. 523102Fold g.18: Complement control module/SCR domain [57534] (1 superfamily)
    disulfide-rich all-beta fold
  4. 523103Superfamily g.18.1: Complement control module/SCR domain [57535] (1 family) (S)
  5. 523104Family g.18.1.1: Complement control module/SCR domain [57536] (10 proteins)
  6. 523271Protein Complement receptor 2, cr2 [64564] (1 species)
  7. 523272Species Human (Homo sapiens) [TaxId:9606] [64565] (2 PDB entries)
  8. 523276Domain d1ghqb2: 1ghq B:67-129 [60523]
    Other proteins in same PDB: d1ghqa_

Details for d1ghqb2

PDB Entry: 1ghq (more details), 2.04 Å

PDB Description: cr2-c3d complex structure

SCOP Domain Sequences for d1ghqb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ghqb2 g.18.1.1 (B:67-129) Complement receptor 2, cr2 {Human (Homo sapiens)}
nkysscpepivpggykirgstpyrhgdsvtfacktnfsmngnksvwcqannmwgptrlpt
cvs

SCOP Domain Coordinates for d1ghqb2:

Click to download the PDB-style file with coordinates for d1ghqb2.
(The format of our PDB-style files is described here.)

Timeline for d1ghqb2: