SCOP 1.71: Domain d1ghqa_: 1ghq A:

Lineage for d1ghqa_ (1ghq A:)

1. Root: SCOP 1.71

2. Class a: All alpha proteins [46456] (226 folds)

3. Fold a.102: alpha/alpha toroid [48207] (5 superfamilies)
   multihelical; up to seven alpha-hairpins are arranged in closed circular array; there may be sequence similarities between different superfamilies

4. Superfamily a.102.4: Terpenoid cyclases/Protein prenyltransferases [48239] (4 families)

5. Family a.102.4.4: Complement components [48251] (2 proteins)
   probably related to other families, but has no known enzymatic activity

6. Protein C3D, a C3 fragment and ligand for complement receptor 2 [48252] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [48253] (2 PDB entries)

8. Domain d1ghqa_: 1ghq A: [60521]
   Other proteins in same PDB: d1ghqb1, d1ghqb2, d1ghqc1, d1ghqc2
   complexed with nag, zn; mutant

Details for d1ghqa_

PDB Entry: 1ghq, 2.04 Å

PDB Description: cr2-c3d complex structure

SCOP Domain Sequences for d1ghqa_:

Sequence; same for both SEQRES and ATOM records:

>d1ghqa_ a.102.4.4 (A:) C3D, a C3 fragment and ligand for complement receptor 2 {Human (Homo sapiens)}
mldaerlkhlivtpsgageqnmigmtptviavhyldeteqwekfglekrqgalelikkgy
tqqlafrqpssafaafvkrapstwltayvvkvfslavnliaidsqvlcgavkwlilekqk
pdgvfqedapvihqemigglrnnnekdmaltafvlislqeakdiceeqvnslpgsitkag
dfleanymnlqrsytvaiagyalaqmgrlkgpllnkflttakdknrwedpgkqlynveat
syallallqlkdfdfvppvvrwlneqryygggygstqatfmvfqalaqyqkdapsdhqel
nldvslq

Timeline for d1ghqa_:

• d1ghqa_ first appeared in SCOP 1.57
  
• d1ghqa_ appears in SCOP 1.69
  
• d1ghqa_ appears in SCOP 1.73
  
• d1ghqa_ appears in the current release, SCOPe 2.08, called d1ghqa1