![]() | Class a: All alpha proteins [46456] (226 folds) |
![]() | Fold a.102: alpha/alpha toroid [48207] (5 superfamilies) multihelical; up to seven alpha-hairpins are arranged in closed circular array; there may be sequence similarities between different superfamilies |
![]() | Superfamily a.102.4: Terpenoid cyclases/Protein prenyltransferases [48239] (4 families) ![]() |
![]() | Family a.102.4.4: Complement components [48251] (2 proteins) probably related to other families, but has no known enzymatic activity |
![]() | Protein C3D, a C3 fragment and ligand for complement receptor 2 [48252] (2 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [48253] (2 PDB entries) |
![]() | Domain d1ghqa_: 1ghq A: [60521] Other proteins in same PDB: d1ghqb1, d1ghqb2, d1ghqc1, d1ghqc2 complexed with nag, zn; mutant |
PDB Entry: 1ghq (more details), 2.04 Å
SCOP Domain Sequences for d1ghqa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ghqa_ a.102.4.4 (A:) C3D, a C3 fragment and ligand for complement receptor 2 {Human (Homo sapiens)} mldaerlkhlivtpsgageqnmigmtptviavhyldeteqwekfglekrqgalelikkgy tqqlafrqpssafaafvkrapstwltayvvkvfslavnliaidsqvlcgavkwlilekqk pdgvfqedapvihqemigglrnnnekdmaltafvlislqeakdiceeqvnslpgsitkag dfleanymnlqrsytvaiagyalaqmgrlkgpllnkflttakdknrwedpgkqlynveat syallallqlkdfdfvppvvrwlneqryygggygstqatfmvfqalaqyqkdapsdhqel nldvslq
Timeline for d1ghqa_:
![]() Domains from other chains: (mouse over for more information) d1ghqb1, d1ghqb2, d1ghqc1, d1ghqc2 |