Lineage for d1ghqa_ (1ghq A:)

  1. Root: SCOP 1.69
  2. 436025Class a: All alpha proteins [46456] (218 folds)
  3. 446542Fold a.102: alpha/alpha toroid [48207] (5 superfamilies)
    multihelical; up to seven alpha-hairpins are arranged in closed circular array; there may be sequence similarities between different superfamilies
  4. 446731Superfamily a.102.4: Terpenoid cyclases/Protein prenyltransferases [48239] (4 families) (S)
  5. 446915Family a.102.4.4: Complement components [48251] (2 proteins)
    probably related to other families, but has no known enzymatic activity
  6. 446916Protein C3D, a C3 fragment and ligand for complement receptor 2 [48252] (2 species)
  7. 446917Species Human (Homo sapiens) [TaxId:9606] [48253] (2 PDB entries)
  8. 446919Domain d1ghqa_: 1ghq A: [60521]
    Other proteins in same PDB: d1ghqb1, d1ghqb2, d1ghqc1, d1ghqc2

Details for d1ghqa_

PDB Entry: 1ghq (more details), 2.04 Å

PDB Description: cr2-c3d complex structure

SCOP Domain Sequences for d1ghqa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ghqa_ a.102.4.4 (A:) C3D, a C3 fragment and ligand for complement receptor 2 {Human (Homo sapiens)}
mldaerlkhlivtpsgageqnmigmtptviavhyldeteqwekfglekrqgalelikkgy
tqqlafrqpssafaafvkrapstwltayvvkvfslavnliaidsqvlcgavkwlilekqk
pdgvfqedapvihqemigglrnnnekdmaltafvlislqeakdiceeqvnslpgsitkag
dfleanymnlqrsytvaiagyalaqmgrlkgpllnkflttakdknrwedpgkqlynveat
syallallqlkdfdfvppvvrwlneqryygggygstqatfmvfqalaqyqkdapsdhqel
nldvslq

SCOP Domain Coordinates for d1ghqa_:

Click to download the PDB-style file with coordinates for d1ghqa_.
(The format of our PDB-style files is described here.)

Timeline for d1ghqa_: