Lineage for d1ghia_ (1ghi A:)

  1. Root: SCOP 1.63
  2. 266016Class e: Multi-domain proteins (alpha and beta) [56572] (39 folds)
  3. 266132Fold e.3: beta-Lactamase/D-ala carboxypeptidase [56600] (1 superfamily)
    contains a cluster of helices and an alpha+beta sandwich
  4. 266133Superfamily e.3.1: beta-Lactamase/D-ala carboxypeptidase [56601] (1 family) (S)
  5. 266134Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (9 proteins)
  6. 266203Protein beta-Lactamase, class A [56606] (13 species)
  7. 266269Species Staphylococcus aureus [TaxId:1280] [56611] (16 PDB entries)
  8. 266277Domain d1ghia_: 1ghi A: [60518]
    complexed with co3; mutant

Details for d1ghia_

PDB Entry: 1ghi (more details), 2.3 Å

PDB Description: structure of beta-lactamase glu166asp:asn170gln mutant

SCOP Domain Sequences for d1ghia_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ghia_ e.3.1.1 (A:) beta-Lactamase, class A {Staphylococcus aureus}
kelndlekkynahigvyaldtksgkevkfnsdkrfayastskainsailleqvpynklnk
kvhinkddivayspilekyvgkditlkalieasmtysdntannkiikeiggikkvkqrlk
elgdkvtnpvrydielqyyspkskkdtstpaafgktlnkliangklskenkkflldlmln
nksgdtlikdgvpkdykvadksgqaityasrndvafvypkgqsepivlviftnkdnksdk
pndklisetaksvmkef

SCOP Domain Coordinates for d1ghia_:

Click to download the PDB-style file with coordinates for d1ghia_.
(The format of our PDB-style files is described here.)

Timeline for d1ghia_: