SCOP 1.59: Domain d1gh2a_: 1gh2 A:

Lineage for d1gh2a_ (1gh2 A:)

1. Root: SCOP 1.59

2. Class c: Alpha and beta proteins (a/b) [51349] (113 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)

4. Superfamily c.47.1: Thioredoxin-like [52833] (12 families)

5. Family c.47.1.1: Thioltransferase [52834] (6 proteins)

6. Protein Thioredoxin-like protein, N-terminal domain [64056] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [64057] (1 PDB entry)

8. Domain d1gh2a_: 1gh2 A: [60515]

Details for d1gh2a_

PDB Entry: 1gh2, 2.22 Å

PDB Description: Crystal structure of the catalytic domain of a new human thioredoxin-like protein

SCOP Domain Sequences for d1gh2a_:

Sequence; same for both SEQRES and ATOM records:

>d1gh2a_ c.47.1.1 (A:) Thioredoxin-like protein, N-terminal domain {Human (Homo sapiens)}
vgvkpvgsdpdfqpelsgagsrlavvkftmrgcgpclriapafssmsnkypqavflevdv
hqcqgtaatnnisatptfqffrnkvridqyqgadavgleekikqhle

Timeline for d1gh2a_:

• d1gh2a_ first appeared in SCOP 1.57
  
• d1gh2a_ appears in SCOP 1.61
  
• d1gh2a_ appears in the current release, SCOPe 2.08