Lineage for d1gh2a_ (1gh2 A:)
- Root: SCOP 1.57
Class c: Alpha and beta proteins (a/b) [51349] (107 folds) 
Fold c.47: Thioredoxin fold [52832] (3 superfamilies) Superfamily c.47.1: Thioredoxin-like [52833] (10 families) 
Family c.47.1.1: Thioltransferase [52834] (5 proteins) 
Protein Thioredoxin-like protein, N-terminal domain [64056] (1 species) Species Human (Homo sapiens) [TaxId:9606] [64057] (1 PDB entry) 
Domain d1gh2a_: 1gh2 A: [60515]
Details for d1gh2a_
PDB Entry: 1gh2 (more details), 2.22 Å
PDB Description: Crystal structure of the catalytic domain of a new human thioredoxin-like protein
SCOP Domain Sequences for d1gh2a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1gh2a_ c.47.1.1 (A:) Thioredoxin-like protein, N-terminal domain {Human (Homo sapiens)}
vgvkpvgsdpdfqpelsgagsrlavvkftmrgcgpclriapafssmsnkypqavflevdv
hqcqgtaatnnisatptfqffrnkvridqyqgadavgleekikqhle
SCOP Domain Coordinates for d1gh2a_:
Click to download the PDB-style file with coordinates for d1gh2a_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1gh2a_:
- d1gh2a_ is new in SCOP 1.57
- d1gh2a_ appears in SCOP 1.59
- d1gh2a_ appears in the current release, SCOPe 2.08
View in 3D