SCOPe 2.02: Domain d1ggla_: 1ggl A:

Lineage for d1ggla_ (1ggl A:)

1. Root: SCOPe 2.02

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.60: Lipocalins [50813] (1 superfamily)
   barrel, closed or opened; n=8, S=12; meander

4. Superfamily b.60.1: Lipocalins [50814] (10 families)
   bind hydrophobic ligands in their interior

5. Family b.60.1.2: Fatty acid binding protein-like [50847] (18 proteins)
   ten-stranded meander beta-sheet folded upon itself
   relates to the common fold by opening the barrel and insertion of beta-hairpin

6. Protein Cellular retinol-binding protein III [63811] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [63812] (1 PDB entry)

8. Domain d1ggla_: 1ggl A: [60484]

Details for d1ggla_

PDB Entry: 1ggl, 2.31 Å

PDB Description: human cellular retinol binding protein iii

PDB Compounds: (A:) protein (cellular retinol-binding protein III)

SCOPe Domain Sequences for d1ggla_:

Sequence; same for both SEQRES and ATOM records:

>d1ggla_ b.60.1.2 (A:) Cellular retinol-binding protein III {Human (Homo sapiens) [TaxId: 9606]}
ppnltgyyrfvsqknmedylqalnislavrkialllkpdkeiehqgnhmtvrtlstfrny
tvqfdvgvefeedlrsvdgrkcqtivtweeehlvcvqkgevpnrgwrhwlegemlylelt
ardavceqvfrkvh

Timeline for d1ggla_:

• d1ggla_ first appeared in SCOP 1.57
  
• d1ggla_ appears in SCOPe 2.01
  
• d1ggla_ appears in SCOPe 2.03
  
• d1ggla_ appears in the current release, SCOPe 2.08