PDB entry 1ggl

View 1ggl on RCSB PDB site
Description: human cellular retinol binding protein III
Class: transport protein
Keywords: carrier, retinol binding protein, transport protein
Deposited on 2000-08-23, released 2001-03-07
The last revision prior to the SCOPe 2.02 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.31 Å
R-factor: 0.229
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (cellular retinol-binding protein III)
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d1ggla_
  • Chain 'B':
    Compound: protein (cellular retinol-binding protein III)
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d1gglb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1gglA (A:)
ppnltgyyrfvsqknmedylqalnislavrkialllkpdkeiehqgnhmtvrtlstfrny
tvqfdvgvefeedlrsvdgrkcqtivtweeehlvcvqkgevpnrgwrhwlegemlylelt
ardavceqvfrkvh

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1gglB (B:)
ppnltgyyrfvsqknmedylqalnislavrkialllkpdkeiehqgnhmtvrtlstfrny
tvqfdvgvefeedlrsvdgrkcqtivtweeehlvcvqkgevpnrgwrhwlegemlylelt
ardavceqvfrkvh