| Class d: Alpha and beta proteins (a+b) [53931] (224 folds) |
| Fold d.92: Zincin-like [55485] (2 superfamilies) contains mixed beta sheet with connection over free side of the sheet |
Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (14 families) ![]() |
| Family d.92.1.12: Fungal zinc peptidase [64335] (1 protein) single domain with insertions in the common fold |
| Protein Fungal zinc peptidase [64336] (2 species) |
| Species Grifola frondosa [64337] (4 PDB entries) |
| Domain d1ge6a_: 1ge6 A: [60460] complexed with man, zn |
PDB Entry: 1ge6 (more details), 2.2 Å
SCOP Domain Sequences for d1ge6a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ge6a_ d.92.1.12 (A:) Fungal zinc peptidase {Grifola frondosa}
cssseqsalaaaasaaqsyvaeslsylqthtaatpryttwfgsyissrhstvlqhytdmn
sndfssysfdctctaagtfayvypnrfgtvylcgafwkapttgtdsqagtlvhesshftr
nggtkdyaygqaaakslatmdpdkavmnadnheyfsennpaqs
Timeline for d1ge6a_: