Lineage for d1ge6a_ (1ge6 A:)

  1. Root: SCOP 1.63
  2. 251695Class d: Alpha and beta proteins (a+b) [53931] (224 folds)
  3. 259924Fold d.92: Zincin-like [55485] (2 superfamilies)
    contains mixed beta sheet with connection over free side of the sheet
  4. 259925Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (14 families) (S)
  5. 260238Family d.92.1.12: Fungal zinc peptidase [64335] (1 protein)
    single domain with insertions in the common fold
  6. 260239Protein Fungal zinc peptidase [64336] (2 species)
  7. 260242Species Grifola frondosa [64337] (4 PDB entries)
  8. 260247Domain d1ge6a_: 1ge6 A: [60460]
    complexed with man, zn

Details for d1ge6a_

PDB Entry: 1ge6 (more details), 2.2 Å

PDB Description: zinc peptidase from grifola frondosa

SCOP Domain Sequences for d1ge6a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ge6a_ d.92.1.12 (A:) Fungal zinc peptidase {Grifola frondosa}
cssseqsalaaaasaaqsyvaeslsylqthtaatpryttwfgsyissrhstvlqhytdmn
sndfssysfdctctaagtfayvypnrfgtvylcgafwkapttgtdsqagtlvhesshftr
nggtkdyaygqaaakslatmdpdkavmnadnheyfsennpaqs

SCOP Domain Coordinates for d1ge6a_:

Click to download the PDB-style file with coordinates for d1ge6a_.
(The format of our PDB-style files is described here.)

Timeline for d1ge6a_: