Lineage for d1gdva_ (1gdv A:)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1476826Fold a.3: Cytochrome c [46625] (1 superfamily)
    core: 3 helices; folded leaf, opened
  4. 1476827Superfamily a.3.1: Cytochrome c [46626] (9 families) (S)
    covalently-bound heme completes the core
  5. 1476828Family a.3.1.1: monodomain cytochrome c [46627] (16 proteins)
  6. 1476982Protein Cytochrome c6 (synonym: cytochrome c553) [46628] (10 species)
  7. 1477017Species Red alga (Porphyra yezoensis) [TaxId:2788] [63458] (1 PDB entry)
  8. 1477018Domain d1gdva_: 1gdv A: [60458]
    complexed with hem

Details for d1gdva_

PDB Entry: 1gdv (more details), 1.57 Å

PDB Description: crystal structure of cytochrome c6 from red alga porphyra yezoensis at 1.57 a resolution
PDB Compounds: (A:) cytochrome c6

SCOPe Domain Sequences for d1gdva_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gdva_ a.3.1.1 (A:) Cytochrome c6 (synonym: cytochrome c553) {Red alga (Porphyra yezoensis) [TaxId: 2788]}
adldngekvfsancaachaggnnaimpdktlkkdvleansmntidaityqvqngknampa
fggrlvdediedaanyvlsqsekgw

SCOPe Domain Coordinates for d1gdva_:

Click to download the PDB-style file with coordinates for d1gdva_.
(The format of our PDB-style files is described here.)

Timeline for d1gdva_: