Lineage for d1gdva_ (1gdv A:)

  1. Root: SCOP 1.57
  2. 43951Class a: All alpha proteins [46456] (144 folds)
  3. 45011Fold a.3: Cytochrome c [46625] (1 superfamily)
  4. 45012Superfamily a.3.1: Cytochrome c [46626] (5 families) (S)
  5. 45013Family a.3.1.1: monodomain cytochrome c [46627] (11 proteins)
  6. 45094Protein Cytochrome c6 (synonym: cytochrome c553) [46628] (9 species)
  7. 45118Species Red alga (Porphyra yezoensis) [TaxId:2788] [63458] (1 PDB entry)
  8. 45119Domain d1gdva_: 1gdv A: [60458]

Details for d1gdva_

PDB Entry: 1gdv (more details), 1.57 Å

PDB Description: crystal structure of cytochrome c6 from red alga porphyra yezoensis at 1.57 a resolution

SCOP Domain Sequences for d1gdva_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gdva_ a.3.1.1 (A:) Cytochrome c6 (synonym: cytochrome c553) {Red alga (Porphyra yezoensis)}
adldngekvfsancaachaggnnaimpdktlkkdvleansmntidaityqvqngknampa
fggrlvdediedaanyvlsqsekgw

SCOP Domain Coordinates for d1gdva_:

Click to download the PDB-style file with coordinates for d1gdva_.
(The format of our PDB-style files is described here.)

Timeline for d1gdva_: