Lineage for d1gdva_ (1gdv A:)
- Root: SCOP 1.57
Class a: All alpha proteins [46456] (144 folds) 
Fold a.3: Cytochrome c [46625] (1 superfamily) Superfamily a.3.1: Cytochrome c [46626] (5 families) 
Family a.3.1.1: monodomain cytochrome c [46627] (11 proteins) Protein Cytochrome c6 (synonym: cytochrome c553) [46628] (9 species) 
Species Red alga (Porphyra yezoensis) [TaxId:2788] [63458] (1 PDB entry) 
Domain d1gdva_: 1gdv A: [60458]
Details for d1gdva_
PDB Entry: 1gdv (more details), 1.57 Å
PDB Description: crystal structure of cytochrome c6 from red alga porphyra yezoensis at 1.57 a resolution
SCOP Domain Sequences for d1gdva_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1gdva_ a.3.1.1 (A:) Cytochrome c6 (synonym: cytochrome c553) {Red alga (Porphyra yezoensis)}
adldngekvfsancaachaggnnaimpdktlkkdvleansmntidaityqvqngknampa
fggrlvdediedaanyvlsqsekgw
SCOP Domain Coordinates for d1gdva_:
Click to download the PDB-style file with coordinates for d1gdva_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1gdva_:
- d1gdva_ is new in SCOP 1.57
- d1gdva_ appears in SCOP 1.59
- d1gdva_ appears in the current release, SCOPe 2.07
View in 3D