Lineage for d1g96a_ (1g96 A:)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1196747Fold d.17: Cystatin-like [54402] (7 superfamilies)
    Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet
  4. 1196748Superfamily d.17.1: Cystatin/monellin [54403] (7 families) (S)
    has a additional strand at the N-terminus
  5. 1196781Family d.17.1.2: Cystatins [54407] (7 proteins)
  6. 1196815Protein Cystatin C [64231] (1 species)
  7. 1196816Species Human (Homo sapiens) [TaxId:9606] [64232] (8 PDB entries)
    Uniprot P01034 37-146
  8. 1196831Domain d1g96a_: 1g96 A: [60393]
    dimeric form with 3d domain swapping; only one monomer in the PDB entry
    complexed with cl, gol

Details for d1g96a_

PDB Entry: 1g96 (more details), 2.5 Å

PDB Description: human cystatin c; dimeric form with 3d domain swapping
PDB Compounds: (A:) Cystatin C

SCOPe Domain Sequences for d1g96a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1g96a_ d.17.1.2 (A:) Cystatin C {Human (Homo sapiens) [TaxId: 9606]}
vggpmdasveeegvrraldfavgeynkasndmyhsralqvvrarkqivagvnyfldvelg
rttctktqpnldncpfhdqphlkrkafcsfqiyavpwqgtmtlskstcqda

SCOPe Domain Coordinates for d1g96a_:

Click to download the PDB-style file with coordinates for d1g96a_.
(The format of our PDB-style files is described here.)

Timeline for d1g96a_: