PDB entry 1g96

View 1g96 on RCSB PDB site
Description: human cystatin c; dimeric form with 3d domain swapping
Class: hydrolase inhibitor
Keywords: human cystatin C dimer, 3D domain swapping, amyloid formation, inhibitor of C1 and C13 cysteine proteases, AMYLOID ANGIOPATHY AND CEREBRAL HEMORRHAGE, hydrolase inhibitor
Deposited on 2000-11-22, released 2001-04-06
The last revision prior to the SCOPe 2.02 freeze date was dated 2011-11-16, with a file datestamp of 2011-11-11.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.22
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Cystatin C
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P01034 (Start-119)
  Domains in SCOPe 2.02: d1g96a_
• Heterogens: CL, GOL, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence, based on SEQRES records: (download)
  

  >1g96A (A:)
  sspgkpprlvggpmdasveeegvrraldfavgeynkasndmyhsralqvvrarkqivagv
  nyfldvelgrttctktqpnldncpfhdqphlkrkafcsfqiyavpwqgtmtlskstcqda
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >1g96A (A:)
  vggpmdasveeegvrraldfavgeynkasndmyhsralqvvrarkqivagvnyfldvelg
  rttctktqpnldncpfhdqphlkrkafcsfqiyavpwqgtmtlskstcqda