Lineage for d1g8pa_ (1g8p A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2109203Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2109204Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2113456Family c.37.1.20: Extended AAA-ATPase domain [81269] (29 protein domains)
    fold is similar to that of RecA, but lacks the last two strands, followed by a family-specific Arg-finger domain
  6. 2113491Protein ATPase subunit of magnesium chelatase, BchI [64040] (1 species)
  7. 2113492Species Rhodobacter capsulatus [TaxId:1061] [64041] (1 PDB entry)
  8. 2113493Domain d1g8pa_: 1g8p A: [60376]
    CASP4

Details for d1g8pa_

PDB Entry: 1g8p (more details), 2.1 Å

PDB Description: crystal structure of bchi subunit of magnesium chelatase
PDB Compounds: (A:) magnesium-chelatase 38 kda subunit

SCOPe Domain Sequences for d1g8pa_:

Sequence, based on SEQRES records: (download)

>d1g8pa_ c.37.1.20 (A:) ATPase subunit of magnesium chelatase, BchI {Rhodobacter capsulatus [TaxId: 1061]}
rpvfpfsaivgqedmklallltavdpgiggvlvfgdrgtgkstavralaallpeieaveg
cpvsspnvemipdwatvlstnvirkptpvvdlplgvsedrvvgaldieraiskgekafep
gllaranrgylyidecnlledhivdllldvaqsgenvverdglsirhparfvlvgsgnpe
egdlrpqlldrfglsvevlsprdvetrvevirrrdtydadpkafleewrpkdmdirnqil
earerlpkveapntalydcaalcialgsdglrgeltllrsaralaalegatavgrdhlkr
vatmalshrlrrdpldeagstarvartveetlp

Sequence, based on observed residues (ATOM records): (download)

>d1g8pa_ c.37.1.20 (A:) ATPase subunit of magnesium chelatase, BchI {Rhodobacter capsulatus [TaxId: 1061]}
rpvfpfsaivgqedmklallltavdpgiggvlvfgdrgtgkstavralaallpeieaveg
cpvsspnvemipdwatvlstnvirkptpvvdlplgvsedrvvgaldieraiskgekafep
gllaranrgylyidecnlledhivdllldvaqsgenvverdglsirhparfvlvgsgnpe
egdlrpqlldrfglsvevlsprdvetrvevirrrdtydadpkafleewrpkdmdirnqil
earerlpkveapntalydcaalcialgsdglrgeltllrsaralaalegatavgrdhlkr
vatmalshrlrvartveetlp

SCOPe Domain Coordinates for d1g8pa_:

Click to download the PDB-style file with coordinates for d1g8pa_.
(The format of our PDB-style files is described here.)

Timeline for d1g8pa_: