Lineage for d1g84a_ (1g84 A:)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1510240Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1510241Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1513476Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 1515164Protein Immunoglobulin heavy chain epsilon constant domain 2, CH2-epsilon [88594] (1 species)
  7. 1515165Species Human (Homo sapiens) [TaxId:9606] [88595] (2 PDB entries)
  8. 1515168Domain d1g84a_: 1g84 A: [60345]

Details for d1g84a_

PDB Entry: 1g84 (more details)

PDB Description: the solution structure of the c epsilon2 domain from ige
PDB Compounds: (A:) immunoglobulin e

SCOPe Domain Sequences for d1g84a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1g84a_ b.1.1.2 (A:) Immunoglobulin heavy chain epsilon constant domain 2, CH2-epsilon {Human (Homo sapiens) [TaxId: 9606]}
srdftpptvkilqsssdggghfpptiqllclvsgytpgtinitwledgqvmdvdlstast
tqegelastqseltlsqkhwlsdrtytcqvtyqghtfedstkksa

SCOPe Domain Coordinates for d1g84a_:

Click to download the PDB-style file with coordinates for d1g84a_.
(The format of our PDB-style files is described here.)

Timeline for d1g84a_: