SCOPe 2.08: Domain d1g84a_: 1g84 A:

Lineage for d1g84a_ (1g84 A:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein Immunoglobulin heavy chain epsilon constant domain 2, CH2-epsilon [88594] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [88595] (3 PDB entries)

8. Domain d1g84a_: 1g84 A: [60345]

Details for d1g84a_

PDB Entry: 1g84

PDB Description: the solution structure of the c epsilon2 domain from ige

PDB Compounds: (A:) immunoglobulin e

SCOPe Domain Sequences for d1g84a_:

Sequence; same for both SEQRES and ATOM records:

>d1g84a_ b.1.1.2 (A:) Immunoglobulin heavy chain epsilon constant domain 2, CH2-epsilon {Human (Homo sapiens) [TaxId: 9606]}
srdftpptvkilqsssdggghfpptiqllclvsgytpgtinitwledgqvmdvdlstast
tqegelastqseltlsqkhwlsdrtytcqvtyqghtfedstkksa

Timeline for d1g84a_:

• d1g84a_ first appeared in SCOP 1.57
  
• d1g84a_ appears in SCOPe 2.07