SCOPe 2.07: Domain d1g2oa_: 1g2o A:

Lineage for d1g2oa_ (1g2o A:)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies)
   core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops

4. Superfamily c.56.2: Purine and uridine phosphorylases [53167] (2 families)
   complex architecture; contains mixed beta-sheet of 8 strands, order 23415867, strands 3, 6 & 7 are antiparallel to the rest; and barrel, closed; n=5, S=8

5. Family c.56.2.1: Purine and uridine phosphorylases [53168] (7 proteins)

6. Protein Purine nucleoside phosphorylase, PNP [53169] (14 species)

7. Species Mycobacterium tuberculosis [TaxId:1773] [64098] (3 PDB entries)

8. Domain d1g2oa_: 1g2o A: [60228]
   complexed with imh, po4

Details for d1g2oa_

PDB Entry: 1g2o, 1.75 Å

PDB Description: crystal structure of purine nucleoside phosphorylase from mycobacterium tuberculosis in complex with a transition-state inhibitor

PDB Compounds: (A:) purine nucleoside phosphorylase

SCOPe Domain Sequences for d1g2oa_:

Sequence; same for both SEQRES and ATOM records:

>d1g2oa_ c.56.2.1 (A:) Purine nucleoside phosphorylase, PNP {Mycobacterium tuberculosis [TaxId: 1773]}
dpdelarraaqviadrtgigehdvavvlgsgwlpavaalgspttvlpqaelpgfvpptaa
ghagellsvpigahrvlvlagrihayeghdlryvvhpvraaraagaqimvltnaagglra
dlqvgqpvlisdhlnltarsplvggefvdltdaysprlrelarqsdpqlaegvyaglpgp
hyetpaeirmlqtlgadlvgmstvhetiaaraagaevlgvslvtnlaagitgeplshaev
laagaasatrmgalladviarf

Timeline for d1g2oa_:

• d1g2oa_ first appeared in SCOP 1.57
  
• d1g2oa_ appears in SCOPe 2.06
  
• d1g2oa_ appears in the current release, SCOPe 2.08