Lineage for d1g2oa_ (1g2o A:)

  1. Root: SCOP 1.57
  2. 64291Class c: Alpha and beta proteins (a/b) [51349] (107 folds)
  3. 72307Fold c.56: Phosphorylase/hydrolase-like [53162] (6 superfamilies)
  4. 72323Superfamily c.56.2: Purine and uridine phosphorylases [53167] (1 family) (S)
  5. 72324Family c.56.2.1: Purine and uridine phosphorylases [53168] (3 protein domains)
  6. 72329Protein Purine nucleoside phosphorylase, PNP [53169] (5 species)
  7. 72364Species Mycobacterium tuberculosis [TaxId:1773] [64098] (2 PDB entries)
  8. 72365Domain d1g2oa_: 1g2o A: [60228]

Details for d1g2oa_

PDB Entry: 1g2o (more details), 1.75 Å

PDB Description: crystal structure of purine nucleoside phosphorylase from mycobacterium tuberculosis in complex with a transition-state inhibitor

SCOP Domain Sequences for d1g2oa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1g2oa_ c.56.2.1 (A:) Purine nucleoside phosphorylase, PNP {Mycobacterium tuberculosis}
dpdelarraaqviadrtgigehdvavvlgsgwlpavaalgspttvlpqaelpgfvpptaa
ghagellsvpigahrvlvlagrihayeghdlryvvhpvraaraagaqimvltnaagglra
dlqvgqpvlisdhlnltarsplvggefvdltdaysprlrelarqsdpqlaegvyaglpgp
hyetpaeirmlqtlgadlvgmstvhetiaaraagaevlgvslvtnlaagitgeplshaev
laagaasatrmgalladviarf

SCOP Domain Coordinates for d1g2oa_:

Click to download the PDB-style file with coordinates for d1g2oa_.
(The format of our PDB-style files is described here.)

Timeline for d1g2oa_: