Lineage for d1g12a_ (1g12 A:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2204982Fold d.92: Zincin-like [55485] (2 superfamilies)
    contains mixed beta sheet with connection over free side of the sheet
  4. 2204983Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (18 families) (S)
  5. 2206000Family d.92.1.12: Fungal zinc peptidase [64335] (1 protein)
    single domain with insertions in the common fold
  6. 2206001Protein Fungal zinc peptidase [64336] (2 species)
  7. 2206004Species Grifola frondosa [TaxId:5627] [64337] (4 PDB entries)
  8. 2206005Domain d1g12a_: 1g12 A: [60193]
    complexed with man, zn

Details for d1g12a_

PDB Entry: 1g12 (more details), 1.6 Å

PDB Description: zinc peptidase from grifola frondosa
PDB Compounds: (A:) peptidyl-lys metalloendopeptidase

SCOPe Domain Sequences for d1g12a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1g12a_ d.92.1.12 (A:) Fungal zinc peptidase {Grifola frondosa [TaxId: 5627]}
tyngcssseqsalaaaasaaqsyvaeslsylqthtaatpryttwfgsyissrhstvlqhy
tdmnsndfssysfdctctaagtfayvypnrfgtvylcgafwkapttgtdsqagtlvhess
hftrnggtkdyaygqaaakslatmdpdkavmnadnheyfsennpaqs

SCOPe Domain Coordinates for d1g12a_:

Click to download the PDB-style file with coordinates for d1g12a_.
(The format of our PDB-style files is described here.)

Timeline for d1g12a_: