PDB entry 1g12

View 1g12 on RCSB PDB site
Description: zinc peptidase from grifola frondosa
Class: hydrolase
Keywords: zinc cordinate,METALLOPROTEASE, HYDROLASE
Deposited on 2000-10-10, released 2001-03-14
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.218
AEROSPACI score: 0.55 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: peptidyl-lys metalloendopeptidase
    Species: Grifola frondosa [TaxId:5627]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1g12a_
  • Heterogens: MAN, ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1g12A (A:)
tyngcssseqsalaaaasaaqsyvaeslsylqthtaatpryttwfgsyissrhstvlqhy
tdmnsndfssysfdctctaagtfayvypnrfgtvylcgafwkapttgtdsqagtlvhess
hftrnggtkdyaygqaaakslatmdpdkavmnadnheyfsennpaqs