Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.113: Nudix [55810] (1 superfamily) beta(2)-alpha-beta(3)-alpha; 3 layers: alpha/beta/alpha; mixed sheet contains beta-grasp motif |
Superfamily d.113.1: Nudix [55811] (8 families) |
Family d.113.1.1: MutT-like [55812] (17 proteins) |
Protein ADP-ribose pyrophosphatase [64365] (4 species) |
Species Escherichia coli [TaxId:562] [64366] (5 PDB entries) |
Domain d1g0sb_: 1g0s B: [60188] CASP4 has additional subdomain(s) that are not in the common domain |
PDB Entry: 1g0s (more details), 1.9 Å
SCOPe Domain Sequences for d1g0sb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1g0sb_ d.113.1.1 (B:) ADP-ribose pyrophosphatase {Escherichia coli [TaxId: 562]} pvtfgkndveiiaretlyrgffsldlyrfrhrlfngqmshevrreiferghaavllpfdp vrdevvlieqiriaaydtsetpwllemvagmieegesvedvarreaieeaglivkrtkpv lsflaspggtserssimvgevdattasgihgladenedirvhvvsreqayqwveegkidn aasvialqwlqlhhqalknewa
Timeline for d1g0sb_: