Lineage for d1g0sb_ (1g0s B:)
- Root: SCOP 1.57
Class d: Alpha and beta proteins (a+b) [53931] (194 folds) 
Fold d.113: Nudix [55810] (1 superfamily) Superfamily d.113.1: Nudix [55811] (2 families) 
Family d.113.1.1: MutT-like [55812] (3 proteins) Protein ADP-ribose pyrophosphatase [64365] (1 species) Species Escherichia coli [TaxId:562] [64366] (3 PDB entries) 
Domain d1g0sb_: 1g0s B: [60188]
Details for d1g0sb_
PDB Entry: 1g0s (more details), 1.9 Å
PDB Description: the crystal structure of the e.coli adp-ribose pyrophosphatase
SCOP Domain Sequences for d1g0sb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1g0sb_ d.113.1.1 (B:) ADP-ribose pyrophosphatase {Escherichia coli}
pvtfgkndveiiaretlyrgffsldlyrfrhrlfngqmshevrreiferghaavllpfdp
vrdevvlieqiriaaydtsetpwllemvagmieegesvedvarreaieeaglivkrtkpv
lsflaspggtserssimvgevdattasgihgladenedirvhvvsreqayqwveegkidn
aasvialqwlqlhhqalknewa
SCOP Domain Coordinates for d1g0sb_:
Click to download the PDB-style file with coordinates for d1g0sb_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1g0sb_:
- d1g0sb_ is new in SCOP 1.57
- d1g0sb_ appears in SCOP 1.59
- d1g0sb_ appears in the current release, SCOPe 2.08
View in 3D
