Lineage for d1g0hb_ (1g0h B:)

  1. Root: SCOP 1.59
  2. 140364Class e: Multi-domain proteins (alpha and beta) [56572] (34 folds)
  3. 140783Fold e.7: Sugar phosphatases [56654] (1 superfamily)
  4. 140784Superfamily e.7.1: Sugar phosphatases [56655] (1 family) (S)
  5. 140785Family e.7.1.1: Sugar phosphatases [56656] (6 proteins)
  6. 140794Protein Archaeal inositol monophosphatase/fructose-1,6-bisphosphatase [56665] (1 species)
  7. 140795Species Archaeon Methanococcus jannaschii, MJ0109 [56666] (3 PDB entries)
  8. 140797Domain d1g0hb_: 1g0h B: [60172]

Details for d1g0hb_

PDB Entry: 1g0h (more details), 2.3 Å

PDB Description: crystal structure of mj0109 gene product inositol monophosphatase-fructose 1,6 bisphosphatase

SCOP Domain Sequences for d1g0hb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1g0hb_ e.7.1.1 (B:) Archaeal inositol monophosphatase/fructose-1,6-bisphosphatase {Archaeon Methanococcus jannaschii, MJ0109}
mkwdeigkniakeiekeilpyfgrkdksyvvgtspsgdeteifdkisedialkylkslnv
nivseelgvidnssewtvvidpidgsfnfingipffafcfgvfknnepyygltyefltks
fyeaykgkgaylngrkikvkdfnpnnivisyypskkidleklrnkvkrvrifgafglemc
yvakgtldavfdvrpkvravdiassyiickeagalitdengdelkfdlnatdrlniivan
skemldiildll

SCOP Domain Coordinates for d1g0hb_:

Click to download the PDB-style file with coordinates for d1g0hb_.
(The format of our PDB-style files is described here.)

Timeline for d1g0hb_: