SCOP 1.57: Domain d1g0hb_: 1g0h B:

Lineage for d1g0hb_ (1g0h B:)

1. Root: SCOP 1.57

2. Class e: Multi-domain proteins (alpha and beta) [56572] (32 folds)

3. Fold e.7: Sugar phosphatases [56654] (1 superfamily)

4. Superfamily e.7.1: Sugar phosphatases [56655] (1 family)

5. Family e.7.1.1: Sugar phosphatases [56656] (6 proteins)

6. Protein Archaeal inositol monophosphatase/fructose-1,6-bisphosphatase [56665] (1 species)

7. Species Archaeon Methanococcus jannaschii, MJ0109 [56666] (3 PDB entries)

8. Domain d1g0hb_: 1g0h B: [60172]

Details for d1g0hb_

PDB Entry: 1g0h, 2.3 Å

PDB Description: crystal structure of mj0109 gene product inositol monophosphatase-fructose 1,6 bisphosphatase

SCOP Domain Sequences for d1g0hb_:

Sequence; same for both SEQRES and ATOM records:

>d1g0hb_ e.7.1.1 (B:) Archaeal inositol monophosphatase/fructose-1,6-bisphosphatase {Archaeon Methanococcus jannaschii, MJ0109}
mkwdeigkniakeiekeilpyfgrkdksyvvgtspsgdeteifdkisedialkylkslnv
nivseelgvidnssewtvvidpidgsfnfingipffafcfgvfknnepyygltyefltks
fyeaykgkgaylngrkikvkdfnpnnivisyypskkidleklrnkvkrvrifgafglemc
yvakgtldavfdvrpkvravdiassyiickeagalitdengdelkfdlnatdrlniivan
skemldiildll

Timeline for d1g0hb_:

• d1g0hb_ is new in SCOP 1.57
  
• d1g0hb_ appears in SCOP 1.59
  
• d1g0hb_ appears in the current release, SCOPe 2.08