Lineage for d1fz8d_ (1fz8 D:)

  1. Root: SCOPe 2.02
  2. 1074916Class a: All alpha proteins [46456] (284 folds)
  3. 1084172Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 1084173Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 1085170Family a.25.1.2: Ribonucleotide reductase-like [47253] (9 proteins)
  6. 1085255Protein Methane monooxygenase hydrolase beta subunit [88792] (2 species)
  7. 1085256Species Methylococcus capsulatus [TaxId:414] [88793] (27 PDB entries)
  8. 1085282Domain d1fz8d_: 1fz8 D: [60125]
    Other proteins in same PDB: d1fz8a_, d1fz8b_, d1fz8e_, d1fz8f_
    complexed with 2bm, ca, fe

Details for d1fz8d_

PDB Entry: 1fz8 (more details), 2.1 Å

PDB Description: methane monooxygenase hydroxylase, form ii cocrystallized with dibromomethane
PDB Compounds: (D:) methane monooxygenase component a, beta chain

SCOPe Domain Sequences for d1fz8d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fz8d_ a.25.1.2 (D:) Methane monooxygenase hydrolase beta subunit {Methylococcus capsulatus [TaxId: 414]}
smlgerrrgltdpemaavilkalpeapldgnnkmgyfvtprwkrlteyealtvyaqpnad
wiaggldwgdwtqkfhggrpswgnettelrtvdwfkhrdplrrwhapyvkdkaeewrytd
rflqgysadgqiramnptwrdefinrywgaflfneyglfnahsqgarealsdvtrvslaf
wgfdkidiaqmiqlergflakivpgfdestavpkaewtngevyksarlaveglwqevfdw
nesafsvhavydalfgqfvrreffqrlaprfgdnltpffinqaqtyfqiakqgvqdlyyn
clgddpefsdynrtvmrnwtgkwleptiaalrdfmglfaklpagttdkeeitaslyrvvd
dwiedyasridfkadrdqivkavlaglk

SCOPe Domain Coordinates for d1fz8d_:

Click to download the PDB-style file with coordinates for d1fz8d_.
(The format of our PDB-style files is described here.)

Timeline for d1fz8d_: