Lineage for d1fz8d_ (1fz8 D:)

  1. Root: SCOP 1.57
  2. 43951Class a: All alpha proteins [46456] (144 folds)
  3. 46712Fold a.25: Ferritin-like [47239] (1 superfamily)
  4. 46713Superfamily a.25.1: Ferritin-like [47240] (2 families) (S)
  5. 46831Family a.25.1.2: Ribonucleotide reductase-like [47253] (4 protein domains)
  6. 46840Protein Methane monooxygenase hydrolase, beta and alpha subunits [47254] (2 species)
  7. 46841Species Methylococcus capsulatus [TaxId:414] [47255] (15 PDB entries)
  8. 46873Domain d1fz8d_: 1fz8 D: [60125]
    Other proteins in same PDB: d1fz8e_, d1fz8f_

Details for d1fz8d_

PDB Entry: 1fz8 (more details), 2.1 Å

PDB Description: methane monooxygenase hydroxylase, form ii cocrystallized with dibromomethane

SCOP Domain Sequences for d1fz8d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fz8d_ a.25.1.2 (D:) Methane monooxygenase hydrolase, beta and alpha subunits {Methylococcus capsulatus}
smlgerrrgltdpemaavilkalpeapldgnnkmgyfvtprwkrlteyealtvyaqpnad
wiaggldwgdwtqkfhggrpswgnettelrtvdwfkhrdplrrwhapyvkdkaeewrytd
rflqgysadgqiramnptwrdefinrywgaflfneyglfnahsqgarealsdvtrvslaf
wgfdkidiaqmiqlergflakivpgfdestavpkaewtngevyksarlaveglwqevfdw
nesafsvhavydalfgqfvrreffqrlaprfgdnltpffinqaqtyfqiakqgvqdlyyn
clgddpefsdynrtvmrnwtgkwleptiaalrdfmglfaklpagttdkeeitaslyrvvd
dwiedyasridfkadrdqivkavlaglk

SCOP Domain Coordinates for d1fz8d_:

Click to download the PDB-style file with coordinates for d1fz8d_.
(The format of our PDB-style files is described here.)

Timeline for d1fz8d_: