Lineage for d1fz6f_ (1fz6 F:)

  1. Root: SCOP 1.61
  2. 148221Class a: All alpha proteins [46456] (151 folds)
  3. 151161Fold a.23: Open three-helical up-and-down bundle [47143] (5 superfamilies)
  4. 151181Superfamily a.23.3: Methane monooxygenase hydrolase, gamma subunit [47152] (1 family) (S)
  5. 151182Family a.23.3.1: Methane monooxygenase hydrolase, gamma subunit [47153] (1 protein)
  6. 151183Protein Methane monooxygenase hydrolase, gamma subunit [47154] (2 species)
  7. 151184Species Methylococcus capsulatus [TaxId:414] [47155] (15 PDB entries)
  8. 151200Domain d1fz6f_: 1fz6 F: [60121]
    Other proteins in same PDB: d1fz6a_, d1fz6b_, d1fz6c_, d1fz6d_

Details for d1fz6f_

PDB Entry: 1fz6 (more details), 2.05 Å

PDB Description: methane monooxygenase hydroxylase, form ii soaked in 1 m methanol

SCOP Domain Sequences for d1fz6f_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fz6f_ a.23.3.1 (F:) Methane monooxygenase hydrolase, gamma subunit {Methylococcus capsulatus}
lgihsndtrdawvnkiaqlntlekaaemlkqfrmdhttpfrnsyeldndylwieakleek
vavlkarafnevdfrhktafgedaksvldgtvakmnaakdkweaekihigfrqaykppim
pvnyfldgerqlgtrlmelrnlnyydtpleelrkqrgvrvvhlqsp

SCOP Domain Coordinates for d1fz6f_:

Click to download the PDB-style file with coordinates for d1fz6f_.
(The format of our PDB-style files is described here.)

Timeline for d1fz6f_: