Lineage for d1fz6f_ (1fz6 F:)
- Root: SCOP 1.59
Class a: All alpha proteins [46456] (151 folds) 
Fold a.23: Open three-helical up-and-down bundle [47143] (5 superfamilies) 
Superfamily a.23.3: Methane monooxygenase hydrolase, gamma subunit [47152] (1 family) 
Family a.23.3.1: Methane monooxygenase hydrolase, gamma subunit [47153] (1 protein) Protein Methane monooxygenase hydrolase, gamma subunit [47154] (2 species) Species Methylococcus capsulatus [TaxId:414] [47155] (15 PDB entries) 
Domain d1fz6f_: 1fz6 F: [60121]
Other proteins in same PDB: d1fz6a_, d1fz6b_, d1fz6c_, d1fz6d_
Details for d1fz6f_
PDB Entry: 1fz6 (more details), 2.05 Å
PDB Description: methane monooxygenase hydroxylase, form ii soaked in 1 m methanol
SCOP Domain Sequences for d1fz6f_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1fz6f_ a.23.3.1 (F:) Methane monooxygenase hydrolase, gamma subunit {Methylococcus capsulatus}
lgihsndtrdawvnkiaqlntlekaaemlkqfrmdhttpfrnsyeldndylwieakleek
vavlkarafnevdfrhktafgedaksvldgtvakmnaakdkweaekihigfrqaykppim
pvnyfldgerqlgtrlmelrnlnyydtpleelrkqrgvrvvhlqsp
SCOP Domain Coordinates for d1fz6f_:
Click to download the PDB-style file with coordinates for d1fz6f_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1fz6f_:
- d1fz6f_ first appeared in SCOP 1.57
- d1fz6f_ appears in SCOP 1.61
- d1fz6f_ appears in the current release, SCOPe 2.08
View in 3D
