Class a: All alpha proteins [46456] (218 folds) |
Fold a.76: Iron-dependent repressor protein, dimerization domain [47978] (1 superfamily) 6 helices, homodimer of 3-helical domains |
Superfamily a.76.1: Iron-dependent repressor protein, dimerization domain [47979] (1 family) |
Family a.76.1.1: Iron-dependent repressor protein, dimerization domain [47980] (3 proteins) |
Protein Iron-dependent regulator [47983] (1 species) |
Species Mycobacterium tuberculosis [TaxId:1773] [47984] (2 PDB entries) |
Domain d1fx7c2: 1fx7 C:65-140 [60095] Other proteins in same PDB: d1fx7a1, d1fx7a3, d1fx7b1, d1fx7b3, d1fx7c1, d1fx7c3, d1fx7d1, d1fx7d3 |
PDB Entry: 1fx7 (more details), 2 Å
SCOP Domain Sequences for d1fx7c2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1fx7c2 a.76.1.1 (C:65-140) Iron-dependent regulator {Mycobacterium tuberculosis} tekgralaiavmrkhrlaerllvdviglpweevhaeacrwehvmsedverrlvkvlnnpt tspfgnpipgldelgv
Timeline for d1fx7c2: