SCOP 1.69: Domain d1fx7a1: 1fx7 A:1-64

Lineage for d1fx7a1 (1fx7 A:1-64)

1. Root: SCOP 1.69

2. Class a: All alpha proteins [46456] (218 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (13 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (55 families)
   contains a small beta-sheet (wing)

5. Family a.4.5.24: Iron-dependent repressor protein [46882] (3 proteins)

6. Protein Iron-dependent regulator IdeR [46885] (1 species)

7. Species Mycobacterium tuberculosis [TaxId:1773] [46886] (2 PDB entries)

8. Domain d1fx7a1: 1fx7 A:1-64 [60088]
   Other proteins in same PDB: d1fx7a2, d1fx7a3, d1fx7b2, d1fx7b3, d1fx7c2, d1fx7c3, d1fx7d2, d1fx7d3

Details for d1fx7a1

PDB Entry: 1fx7, 2 Å

PDB Description: crystal structure of the iron-dependent regulator (ider) from mycobacterium tuberculosis

SCOP Domain Sequences for d1fx7a1:

Sequence; same for both SEQRES and ATOM records:

>d1fx7a1 a.4.5.24 (A:1-64) Iron-dependent regulator IdeR {Mycobacterium tuberculosis}
mnelvdttemylrtiydleeegvtplrariaerldqsgptvsqtvsrmerdgllrvagdr
hlel

Timeline for d1fx7a1:

• d1fx7a1 first appeared in SCOP 1.57
  
• d1fx7a1 appears in SCOP 1.67
  
• d1fx7a1 appears in SCOP 1.71
  
• d1fx7a1 appears in the current release, SCOPe 2.08