Lineage for d1fx7b2 (1fx7 B:65-140)

  1. Root: SCOP 1.69
  2. 436025Class a: All alpha proteins [46456] (218 folds)
  3. 445428Fold a.76: Iron-dependent repressor protein, dimerization domain [47978] (1 superfamily)
    6 helices, homodimer of 3-helical domains
  4. 445429Superfamily a.76.1: Iron-dependent repressor protein, dimerization domain [47979] (1 family) (S)
  5. 445430Family a.76.1.1: Iron-dependent repressor protein, dimerization domain [47980] (3 proteins)
  6. 445462Protein Iron-dependent regulator [47983] (1 species)
  7. 445463Species Mycobacterium tuberculosis [TaxId:1773] [47984] (2 PDB entries)
  8. 445465Domain d1fx7b2: 1fx7 B:65-140 [60092]
    Other proteins in same PDB: d1fx7a1, d1fx7a3, d1fx7b1, d1fx7b3, d1fx7c1, d1fx7c3, d1fx7d1, d1fx7d3

Details for d1fx7b2

PDB Entry: 1fx7 (more details), 2 Å

PDB Description: crystal structure of the iron-dependent regulator (ider) from mycobacterium tuberculosis

SCOP Domain Sequences for d1fx7b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fx7b2 a.76.1.1 (B:65-140) Iron-dependent regulator {Mycobacterium tuberculosis}
tekgralaiavmrkhrlaerllvdviglpweevhaeacrwehvmsedverrlvkvlnnpt
tspfgnpipgldelgv

SCOP Domain Coordinates for d1fx7b2:

Click to download the PDB-style file with coordinates for d1fx7b2.
(The format of our PDB-style files is described here.)

Timeline for d1fx7b2: