Lineage for d1fx0a2 (1fx0 A:25-96)

  1. Root: SCOP 1.71
  2. 546417Class b: All beta proteins [48724] (149 folds)
  3. 562760Fold b.49: Domain of alpha and beta subunits of F1 ATP synthase-like [50614] (3 superfamilies)
    barrel, closed; n=6, S=8; greek-key
  4. 562761Superfamily b.49.1: N-terminal domain of alpha and beta subunits of F1 ATP synthase [50615] (1 family) (S)
  5. 562762Family b.49.1.1: N-terminal domain of alpha and beta subunits of F1 ATP synthase [50616] (2 proteins)
    6 domains form a ring structure which contains a barrel, closed; n=24, S=24(?)
  6. 562763Protein F1 ATP synthase alpha subunit, domain 1 [88672] (4 species)
  7. 562805Species Spinach (Spinacia oleracea), chloroplast [TaxId:3562] [88676] (2 PDB entries)
  8. 562807Domain d1fx0a2: 1fx0 A:25-96 [60081]
    Other proteins in same PDB: d1fx0a1, d1fx0a3, d1fx0b1, d1fx0b2, d1fx0b3

Details for d1fx0a2

PDB Entry: 1fx0 (more details), 3.2 Å

PDB Description: crystal structure of the chloroplast f1-atpase from spinach

SCOP Domain Sequences for d1fx0a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fx0a2 b.49.1.1 (A:25-96) F1 ATP synthase alpha subunit, domain 1 {Spinach (Spinacia oleracea), chloroplast}
kvvntgtvlqvgdgiarihgldevmagelvefeegtigialnlesnnvgvvlmgdglmiq
egssvkatgria

SCOP Domain Coordinates for d1fx0a2:

Click to download the PDB-style file with coordinates for d1fx0a2.
(The format of our PDB-style files is described here.)

Timeline for d1fx0a2: