Lineage for d1fx0a2 (1fx0 A:25-96)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2058388Fold b.49: Domain of alpha and beta subunits of F1 ATP synthase-like [50614] (3 superfamilies)
    barrel, closed; n=6, S=8; greek-key
  4. 2058389Superfamily b.49.1: N-terminal domain of alpha and beta (or A/B) subunits of rotary ATPases [50615] (3 families) (S)
    automatically mapped to Pfam PF02874
  5. 2058390Family b.49.1.1: N-terminal domain of alpha and beta subunits of F1 ATP synthase [50616] (2 protein domains)
    6 domains form a ring structure which contains a barrel, closed; n=24, S=24(?)
  6. 2058391Protein F1 ATP synthase alpha subunit, domain 1 [88672] (5 species)
  7. 2058458Species Spinach (Spinacia oleracea), chloroplast [TaxId:3562] [88676] (2 PDB entries)
  8. 2058459Domain d1fx0a2: 1fx0 A:25-96 [60081]
    Other proteins in same PDB: d1fx0a1, d1fx0a3, d1fx0b1, d1fx0b2, d1fx0b3

Details for d1fx0a2

PDB Entry: 1fx0 (more details), 3.2 Å

PDB Description: Crystal structure of the chloroplast F1-ATPase from spinach
PDB Compounds: (A:) ATP synthase alpha chain

SCOPe Domain Sequences for d1fx0a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fx0a2 b.49.1.1 (A:25-96) F1 ATP synthase alpha subunit, domain 1 {Spinach (Spinacia oleracea), chloroplast [TaxId: 3562]}
kvvntgtvlqvgdgiarihgldevmagelvefeegtigialnlesnnvgvvlmgdglmiq
egssvkatgria

SCOPe Domain Coordinates for d1fx0a2:

Click to download the PDB-style file with coordinates for d1fx0a2.
(The format of our PDB-style files is described here.)

Timeline for d1fx0a2: