Class b: All beta proteins [48724] (165 folds) |
Fold b.49: Domain of alpha and beta subunits of F1 ATP synthase-like [50614] (3 superfamilies) barrel, closed; n=6, S=8; greek-key |
Superfamily b.49.1: N-terminal domain of alpha and beta subunits of F1 ATP synthase [50615] (1 family) |
Family b.49.1.1: N-terminal domain of alpha and beta subunits of F1 ATP synthase [50616] (2 proteins) 6 domains form a ring structure which contains a barrel, closed; n=24, S=24(?) |
Protein F1 ATP synthase alpha subunit, domain 1 [88672] (4 species) |
Species Spinach (Spinacia oleracea), chloroplast [TaxId:3562] [88676] (2 PDB entries) |
Domain d1fx0a2: 1fx0 A:25-96 [60081] Other proteins in same PDB: d1fx0a1, d1fx0a3, d1fx0b1, d1fx0b2, d1fx0b3 |
PDB Entry: 1fx0 (more details), 3.2 Å
SCOP Domain Sequences for d1fx0a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1fx0a2 b.49.1.1 (A:25-96) F1 ATP synthase alpha subunit, domain 1 {Spinach (Spinacia oleracea), chloroplast [TaxId: 3562]} kvvntgtvlqvgdgiarihgldevmagelvefeegtigialnlesnnvgvvlmgdglmiq egssvkatgria
Timeline for d1fx0a2: