Class c: Alpha and beta proteins (a/b) [51349] (130 folds) |
Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
Superfamily c.47.1: Thioredoxin-like [52833] (14 families) |
Family c.47.1.5: Glutathione S-transferase (GST), N-terminal domain [52862] (16 proteins) |
Protein Class zeta GST [81364] (2 species) |
Species Human (Homo sapiens) [TaxId:9606] [64058] (1 PDB entry) maleylacetoacetate isomerase |
Domain d1fw1a2: 1fw1 A:5-87 [60052] Other proteins in same PDB: d1fw1a1 complexed with dtt, gsh, so4 |
PDB Entry: 1fw1 (more details), 1.9 Å
SCOP Domain Sequences for d1fw1a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1fw1a2 c.47.1.5 (A:5-87) Class zeta GST {Human (Homo sapiens)} kpilysyfrsscswrvrialalkgidyktvpinlikdggqqfskdfqalnpmkqvptlki dgitihqslaiieyleetrptpr
Timeline for d1fw1a2: