Lineage for d1fw1a2 (1fw1 A:5-87)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2876126Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2876127Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2876589Family c.47.1.5: Glutathione S-transferase (GST), N-terminal domain [52862] (19 proteins)
  6. 2877226Protein Class zeta GST [81364] (2 species)
  7. 2877227Species Human (Homo sapiens) [TaxId:9606] [64058] (1 PDB entry)
    maleylacetoacetate isomerase
  8. 2877228Domain d1fw1a2: 1fw1 A:5-87 [60052]
    Other proteins in same PDB: d1fw1a1
    complexed with dtt, gsh, so4

Details for d1fw1a2

PDB Entry: 1fw1 (more details), 1.9 Å

PDB Description: Glutathione transferase zeta/maleylacetoacetate isomerase
PDB Compounds: (A:) glutathione transferase zeta

SCOPe Domain Sequences for d1fw1a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fw1a2 c.47.1.5 (A:5-87) Class zeta GST {Human (Homo sapiens) [TaxId: 9606]}
kpilysyfrsscswrvrialalkgidyktvpinlikdggqqfskdfqalnpmkqvptlki
dgitihqslaiieyleetrptpr

SCOPe Domain Coordinates for d1fw1a2:

Click to download the PDB-style file with coordinates for d1fw1a2.
(The format of our PDB-style files is described here.)

Timeline for d1fw1a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1fw1a1