Lineage for d1fw1a2 (1fw1 A:5-87)

  1. Root: SCOP 1.57
  2. 64291Class c: Alpha and beta proteins (a/b) [51349] (107 folds)
  3. 70801Fold c.47: Thioredoxin fold [52832] (3 superfamilies)
  4. 70802Superfamily c.47.1: Thioredoxin-like [52833] (10 families) (S)
  5. 70930Family c.47.1.5: Glutathione S-transferases, N-terminal domain [52862] (3 proteins)
  6. 70934Protein Glutathione S-transferase [52863] (24 species)
  7. 71084Species Human (Homo sapiens), class zeta [TaxId:9606] [64058] (1 PDB entry)
  8. 71085Domain d1fw1a2: 1fw1 A:5-87 [60052]
    Other proteins in same PDB: d1fw1a1

Details for d1fw1a2

PDB Entry: 1fw1 (more details), 1.9 Å

PDB Description: Glutathione transferase zeta/maleylacetoacetate isomerase

SCOP Domain Sequences for d1fw1a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fw1a2 c.47.1.5 (A:5-87) Glutathione S-transferase {Human (Homo sapiens), class zeta}
kpilysyfrsscswrvrialalkgidyktvpinlikdggqqfskdfqalnpmkqvptlki
dgitihqslaiieyleetrptpr

SCOP Domain Coordinates for d1fw1a2:

Click to download the PDB-style file with coordinates for d1fw1a2.
(The format of our PDB-style files is described here.)

Timeline for d1fw1a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1fw1a1