Class b: All beta proteins [48724] (174 folds) |
Fold b.17: PEBP-like [49776] (1 superfamily) sandwich; 8 strands in 2 sheets; greek-key: partial topological similarity to immunoglobulin-like folds |
Superfamily b.17.1: PEBP-like [49777] (3 families) |
Family b.17.1.2: Prokaryotic PEBP-like proteins [63701] (2 proteins) |
Protein Hypothetical protein YbcL [63704] (1 species) |
Species Escherichia coli [TaxId:562] [63705] (1 PDB entry) |
Domain d1fuxa_: 1fux A: [60034] |
PDB Entry: 1fux (more details), 1.81 Å
SCOPe Domain Sequences for d1fuxa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1fuxa_ b.17.1.2 (A:) Hypothetical protein YbcL {Escherichia coli [TaxId: 562]} efqvtsneiktgeqlttshvfsgfgceggntspsltwsgvpegtksfavtvydpdaptgs gwwhwtvvnipatvtylpvdagrrdgtklptgavqgrndfgyagfggacppkgdkphhyq fkvwalktekipvdsnssgalvgymlnankiataeitpvyeikle
Timeline for d1fuxa_: