Lineage for d1fuxa_ (1fux A:)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1304915Fold b.17: PEBP-like [49776] (1 superfamily)
    sandwich; 8 strands in 2 sheets; greek-key: partial topological similarity to immunoglobulin-like folds
  4. 1304916Superfamily b.17.1: PEBP-like [49777] (3 families) (S)
  5. 1304947Family b.17.1.2: Prokaryotic PEBP-like proteins [63701] (2 proteins)
    automatically mapped to Pfam PF01161
  6. 1304948Protein Hypothetical protein YbcL [63704] (1 species)
  7. 1304949Species Escherichia coli [TaxId:562] [63705] (1 PDB entry)
  8. 1304950Domain d1fuxa_: 1fux A: [60034]

Details for d1fuxa_

PDB Entry: 1fux (more details), 1.81 Å

PDB Description: crystal structure of e.coli ybcl, a new member of the mammalian pebp family
PDB Compounds: (A:) hypothetical 19.5 kda protein in emre-rus intergenic region

SCOPe Domain Sequences for d1fuxa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fuxa_ b.17.1.2 (A:) Hypothetical protein YbcL {Escherichia coli [TaxId: 562]}
efqvtsneiktgeqlttshvfsgfgceggntspsltwsgvpegtksfavtvydpdaptgs
gwwhwtvvnipatvtylpvdagrrdgtklptgavqgrndfgyagfggacppkgdkphhyq
fkvwalktekipvdsnssgalvgymlnankiataeitpvyeikle

SCOPe Domain Coordinates for d1fuxa_:

Click to download the PDB-style file with coordinates for d1fuxa_.
(The format of our PDB-style files is described here.)

Timeline for d1fuxa_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1fuxb_